PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584931.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 255aa    MW: 28483.3 Da    PI: 8.4808
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584931.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-163279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd++lv  +++ G g+W++ +++ g+ R++k+c++rw +yl
   XP_013584931.1 32 RGPWTVEEDKILVSFIEKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYL 79
                     89******************************99************97 PP

2Myb_DNA-binding445.2e-1490130648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++ G++ W++Ia +++ gRt++++k++w+++l
   XP_013584931.1  90 PDEEDLILRLHRLIGNK-WSLIAGRIP-GRTDNEIKNYWNTHL 130
                      79***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-212381IPR009057Homeodomain-like
PROSITE profilePS5129415.5282779IPR017930Myb domain
SuperFamilySSF466897.76E-2928126IPR009057Homeodomain-like
SMARTSM007175.5E-133181IPR001005SANT/Myb domain
PfamPF002497.5E-153279IPR001005SANT/Myb domain
CDDcd001672.31E-113479No hitNo description
PROSITE profilePS5129422.64880134IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2482134IPR009057Homeodomain-like
SMARTSM007172.3E-1284132IPR001005SANT/Myb domain
PfamPF002495.8E-1390130IPR001005SANT/Myb domain
CDDcd001671.63E-1090130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MLKTVDMTSS SGKRSVAKKM TTPCCTKMGM KRGPWTVEED KILVSFIEKE GEGRWRSLPK  60
RAGLLRCGKS CRLRWMNYLR PSVKRGGIAP DEEDLILRLH RLIGNKWSLI AGRIPGRTDN  120
EIKNYWNTHL RKKLLSQGID PQTHKPLDAS YTRKPIEEVS GGQNLLEPNS NSHTDDTTVS  180
SGSGAGKISV SVFGDEDFGF CYDDKFSSFL NSVINDDPFD SNIPILSQPL QTHDFIGEIV  240
GTSSSLGHDQ RPEDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-253013425128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584931.10.0PREDICTED: transcription repressor MYB5
RefseqXP_013741458.10.0PREDICTED: transcription repressor MYB5-like
SwissprotQ388501e-134MYB5_ARATH; Transcription repressor MYB5
TrEMBLM4EF610.0M4EF61_BRARP; Uncharacterized protein
STRINGBra027423.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-136myb domain protein 5